PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10017867m
Common NameCICLE_v10017867mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 226aa    MW: 25808.8 Da    PI: 7.7311
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10017867mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.8e-3292145255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      prlrWtp+LH +Fv+ave+LGG+ekAtPk +l+lm+v gL+++hvkSHLQ+YR+
  Ciclev10017867m  92 PRLRWTPDLHLSFVHAVERLGGQEKATPKLVLQLMNVRGLSIAHVKSHLQMYRS 145
                      8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.62888148IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-3088146IPR009057Homeodomain-like
SuperFamilySSF466898.96E-1590146IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-2392147IPR006447Myb domain, plants
PfamPF002494.1E-993144IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MRTDLEIQCR QEKSDRSEEQ AENTSVVSPQ KWSCFDLNLN EEASCSEEDD VLANAAEDDD  60
KRTDHLEGST SCSTNNNERR STVRQYVRSK MPRLRWTPDL HLSFVHAVER LGGQEKATPK  120
LVLQLMNVRG LSIAHVKSHL QMYRSKKLDE AGQVLSHAYR SIHGRDHIRG IYHQPVITSP  180
HHHFRLENGG IVLASNNFHE NSITRNILQS PISQRPLDFK STFSR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006449512.11e-169hypothetical protein CICLE_v10017867mg
TrEMBLV4U9V51e-169V4U9V5_9R
STRINGGLYMA08G12320.22e-64(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.18e-40G2-like family protein